XB-FEAT-982798
h1-10.2
This is the community wiki page for the gene h1-10.2 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
26APRIL2023 gene symbol changed from mgc69473 to rbm43-like to reflect provisional orthology group.
11NOV2026 Genes on this gene page have changed name, from rbm43l, rbm43-like to h1-10.2, H1.10 linker histone gene 2.
The X.laevis S gene has been placed here too, as it is the 2nd histone linker gene, its name changed from the provisional annotation, LOC100192369, sperm-specific nuclear basic protein 1 to h1-10.2.S.
This update is supported by synteny and BLAST, and was reported by RefSeq curator Anjana Vatsan(JIRA: RSCOM-1023).
Note that the X.tropicalis gene (GeneID:407914) has been reassigned as h1-10 (aka h1-10.1), and GeneID:549453 has moved to this gene page to be the duplicated gene, h1-10.2.
protein
uncharacterized protein LOC407914 [Xenopus tropicalis]
NCBI Reference Sequence: NP_001001233.1
>NP_001001233.1 uncharacterized protein LOC407914 [Xenopus tropicalis]
MALELEENLHSEEEEEEDEEEEEEEEEEEEEEEEEEEEEGGGMQTRSPSKRNKGGASSSSSSSGSAKKKK
KKKNQPGRYSQLVVDTIRKLGERNGSSLAKIYSEAKKVAWFDQQNGRTYLKYSIKALVQNDTLLQVKGVG
ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK
GAKGKKVKKGAKPSVPKVPKSKKA
orthology
02MAY2024
DIOPT/EggNog matches this protein ( omitting the long string of EEEEEs) matching >600 proteins from >200 species including reptiles and mammals.
Matches to Mouse and rat, below, show that this is likely a 'histone 1 ' but the gene symbol to be use here is unclear:
Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c
Rattus norvegicus 9 seqs 10116.ENSRNOP00000019696, 10116.ENSRNOP00000065338, 10116.ENSRNOP00000023054, 10116.ENSRNOP00000006172, 10116.ENSRNOP00000048205, 10116.ENSRNOP00000032882, 10116.ENSRNOP00000066786, 10116.ENSRNOP00000024304, 10116.ENSRNOP00000053053 Hp1bp3, LOC684828, Hist1h1a, Rbm43, H1foo, H1fx, Hist1h1d, Hist1h1b, H1f0
Gene name/symbol wise, we might goin with 'rbm43-like' for now for simplicity. Further Analysis would be necessary to name more precisely.