XB-FEAT-5740333
LOC100145131
This is the community wiki page for the gene LOC100145131 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
12/05/2016
Human symbol has changed for genepage ID: 5740333 From loc440330 to loc105371184
10.18.2019
Human symbol has changed for Entrez Gene: 105371184. From LOC105371184 to linc02867
10.FEB.2021
Human symbol has changed for genepage ID: 5740333 From linc02867 to STUB1-DT, STUB1 divergent transcript . a psuedo gene in Humans.
XB curators decided to keep this gene name as is, unchanged, as even though it is annotated/named as a non-coding lncRNA, it appears it to be functional protein coding gene in Xenopus.
Note there is no gene in Xla.S
Do not gene change name unless further compelling evidence is presented/published.
10NOV2026
NCBI refSeq brought this loci to our attention again, asking us to asign STUB1-DT as its human ortholog. (RSCOM-1025)
We have unpaged teh Xenopus gene synbol & name from linc02867 to uncharacterised LOC#
A better name is under discussion.
My reply : We have looked at this loci before, and although the human STUB1-DT shares synteny to the X. trop gene as you have pointed out, I do not see that it is an ortholog, yet we agree the Xenopus genes should be renamed as a pc gene. I assessed whether it is a duplicate/version of stub1, but the protein alignment doesn't show any sequence similarity (<10%, comparing the 2 adjacent Xtrop proteins XP_012825523.2 v NP_001072347.1) ). It does not BLAST to any other STUB1 genes. Earlier, I also compared in EggNog, which showed this pc gene is conserved across >200 taxa , mostly amphibians, reptiles and fish, but it is "uncharacteried"in all taxa. If it's not a version of stub1, then it doesn't make sense to assign a pseuogene of human STUB1 as its ortholog. Interpro suggests it contains a DNA glycosylase domain. Panther family suggestion is a little all over the place- perhaps Amun isoform A. We would defintiely like to give it a name however, but currently have it as uncharactered Loc### ( ie changed from linc02867). We could go with a version of 'DNA glycosylase domain containing protein '. What do you suggest? Christina
synteny maps
07JUNE2023
Xtr: linc02867< stub1> jmjd8<. XB5729975< LOC100487504[trim25]<
Xla.L LOC108701691[trim25] jmjd8.L> stub1.L> loc440330.L(gene30787) rhbdl1.L<
Xla.S XB5729975> stub1.S< rhbdl1.S< (note: not present in S)
Human: ROT2> LOC#> RHBDL1> STUB-DT<. STUB1> JMJD8<. WDR24<
Notes: Although Human STUB-DT1 and the Xenopus linc02867/loc440330 are both flanked by STUVB1 and RHBDL1, these are not the same/orthologous genes.
NCBI also doesnt identify either Xenopus gene as orthologs of STUB_DT1- mentioning on 3 orthogs (in hedgehog, opossum and green anole).
XB has therefore remove the human STUB-DT1 [Gene ID: 105371184] from this gene page.
DIOPT orthology group analysis
Using the below seq, the EggNog tool matches this protein with >250 proteins from 235 species, including many fish mammals, with Xenopus [8364.ENSXETP00000061708], Danio rerio [7955.ENSDARP00000066582 zgc:112496]; Xiphophorus maculatus [8083.ENSXMAP00000019006].
Unfortiunately none of these close homologs are named in an informative manner, and no functional annotations are retrieved. It's a mystery protein!
Xtrop.linc02867 Entrez Gene: 100145131
>NP_001120112.1 uncharacterized protein LOC100145131 [Xenopus tropicalis] MAQNSGLFHSEDPAVWQKASDIYWDVIAAKGAKQKKLVSLDKWFQEELPPCIAARPHKHLTREELVKLME WKLTRGKFRPRLQQLVASNPDGAVETCTEKAFKLLPEVSAAINELCQLKGIGPATASAVLAAGAPELTAF MADEAVESIPGLTPVQYTLKHYLRYLEELRKKAAALSTEGSSEKWTPHQVELCLWAWEVARKLCPNLLGS QESGKIEERPKKKLKTK